DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Hoxb7

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:89 Identity:30/89 - (33%)
Similarity:45/89 - (50%) Gaps:14/89 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QRRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRKAERL 113
            ::|.|.|:|..|..|||..|   ||....||.   ::|..:.|||.::::||||||.||:|    
Mouse   137 RKRGRQTYTRYQTLELEKEF---HYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKK---- 194

  Fly   114 KDEQRKRENGESSSSLDKLHDSRE 137
                ..:.:|..::..||.....|
Mouse   195 ----ENKTSGPGTTGQDKAEAEEE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 25/58 (43%)
OAR 428..446 CDD:461067
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131
Homeodomain 138..194 CDD:459649 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.