DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Hesx1

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_034550.2 Gene:Hesx1 / 15209 MGIID:96071 Length:185 Species:Mus musculus


Alignment Length:134 Identity:47/134 - (35%)
Similarity:62/134 - (46%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CPPALHP-------CGP---------HPPRLPT-LDYPFAATHPYTS------YSYHPAIHDETF 47
            |..::.|       ||.         |.|.||: ..:|....||...      .:|..|....:.
Mouse    35 CTTSVRPHRPWTDTCGDSEKGGNPPLHAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSL 99

  Fly    48 VRR----KQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWR 108
            .|.    :.||.||.||..|:|.||..|....||.:..|||||.|:||.|.|:|:||||||||.:
Mouse   100 KRELSWYRGRRPRTAFTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMK 164

  Fly   109 KAER 112
            ::.|
Mouse   165 RSRR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 32/55 (58%)
OAR 428..446 CDD:461067
Hesx1NP_034550.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..69 8/33 (24%)
Homeodomain 109..165 CDD:459649 32/55 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.