DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Cdx1

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_034010.3 Gene:Cdx1 / 12590 MGIID:88360 Length:268 Species:Mus musculus


Alignment Length:249 Identity:59/249 - (23%)
Similarity:81/249 - (32%) Gaps:108/249 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PALHPCGPHPPRL-PTLDYPFAATHP----YTSYSYHPAIHDETFVRR-----------KQR--- 53
            |...|.||.|..| .:|..|.|.:.|    .|.|.:         :||           |.|   
Mouse   100 PVPAPPGPGPGILAQSLGAPGAPSSPGAPRRTPYEW---------MRRSVAAAGGGGSGKTRTKD 155

  Fly    54 RNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQR 118
            :.|..:|..|..|||..|..:.|..:..:.:||..:.|||.:|::||||||||.||..:.|.:|:
Mouse   156 KYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQ 220

  Fly   119 KRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRS 183
            :                                .|||.|                          
Mouse   221 Q--------------------------------PLPPTQ-------------------------- 227

  Fly   184 PGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSIS------AGSPSPSGMHRE 231
                         .||   .|..||..:...|||:.      .|:|||..:..|
Mouse   228 -------------LPL---PLDGTPTPSGPPLGSLCPTNAGLLGTPSPVPVKEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 23/58 (40%)
OAR 428..446 CDD:461067
Cdx1NP_034010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 15/60 (25%)
Caudal_act 13..140 CDD:461413 14/48 (29%)
Homeodomain 156..211 CDD:459649 22/54 (41%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 157..178 7/20 (35%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 196..207 6/10 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..268 21/131 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.