DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and alx4

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_004913406.1 Gene:alx4 / 100493396 XenbaseID:XB-GENE-853003 Length:376 Species:Xenopus tropicalis


Alignment Length:238 Identity:86/238 - (36%)
Similarity:109/238 - (45%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKD 115
            |:||||||||..||||||..|.:||||||:.||.|||:.:|||||||||||||||||||.||...
 Frog   180 KKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQ 244

  Fly   116 EQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSH 180
            .|:.|.:..|:..|          |.:|            |..:::.:.|            .|.
 Frog   245 MQQVRTHFSSAYEL----------PLLT------------RAENYAQIQN------------PSW 275

  Fly   181 SRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSIS--AGSPSPSGMHREREHT-PLVGGGG 242
            ..:.|||..:.:.  ..|..:.....:|||...|.|.:|  ...|.| |.|..:.|. .|.|...
 Frog   276 IGNNGGGSPVPAC--VVPCDTVSSCMSPHSHPHSAGGVSEFLSVPGP-GAHVGQTHMGGLFGSAA 337

  Fly   243 QGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPT 285
            .||.......||    |.....|.....||.|..:::|.|..|
 Frog   338 MGPGINGYDLNT----EPDRKSSSIAALRMKAKEHSAAMSWAT 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 39/51 (76%)
OAR 428..445 CDD:281777
alx4XP_004913406.1 COG5576 120..266 CDD:227863 55/107 (51%)
Homeobox 185..238 CDD:365835 40/52 (77%)
OAR 352..370 CDD:367680 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.