DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and hoxc5

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_002936695.2 Gene:hoxc5 / 100487879 XenbaseID:XB-GENE-485672 Length:225 Species:Xenopus tropicalis


Alignment Length:67 Identity:25/67 - (37%)
Similarity:41/67 - (61%) Gaps:6/67 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRKAERLK 114
            :|:||::|..|..|||..|   |:....||.   ::|..:.|.|.::::||||||.||:|..::|
 Frog   159 KRSRTSYTRYQTLELEKEF---HFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDTKVK 220

  Fly   115 DE 116
            .:
 Frog   221 SK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 23/58 (40%)
OAR 428..446 CDD:461067
hoxc5XP_002936695.2 Homeodomain 159..215 CDD:459649 23/58 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.