DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and phox2a

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001239128.1 Gene:phox2a / 100486496 XenbaseID:XB-GENE-853857 Length:281 Species:Xenopus tropicalis


Alignment Length:249 Identity:91/249 - (36%)
Similarity:116/249 - (46%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CPP------ALHPCGPHPPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQL 64
            |||      .|.....|.|.      |: :|.||..:|....|::    :|||||.|||||..||
 Frog    51 CPPLTTANCTLGALRDHQPS------PY-STVPYKFFSDPSGINE----KRKQRRIRTTFTSSQL 104

  Fly    65 EELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKRENGESSSSL 129
            :|||..||:|||||::|||:||:||:||||||||||||||||:||.||..:.:....|...|.  
 Frog   105 KELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAANSKSGSSNNGGSG-- 167

  Fly   130 DKLHDSRESSPDITGE------IDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGM 188
            :|..|.|.||.|...:      ..|....||.....:||              ..|.|.|||...
 Frog   168 NKKSDPRSSSEDDESKESNCSPTPDSTASLPTAGNLNSP--------------GGSLSPSPGAVS 218

  Fly   189 HLDSSDNERPLSSNQLTATPHSASQSLGSI------SAGSPSP-----SGMHRE 231
            .|.|:...:.|........|.|:|.|...:      :...|.|     |..||:
 Frog   219 GLVSAHTVQALKGPAWPGVPTSSSTSTAELLKAWQPAEAVPGPFAGVLSTFHRK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 40/51 (78%)
OAR 428..445 CDD:281777
phox2aNP_001239128.1 Homeobox 96..148 CDD:278475 40/51 (78%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.