DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and rax

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_002936715.1 Gene:rax / 100038124 XenbaseID:XB-GENE-492665 Length:326 Species:Xenopus tropicalis


Alignment Length:417 Identity:111/417 - (26%)
Similarity:141/417 - (33%) Gaps:228/417 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWR 108
            ||...::|.||||||||..||.|||.||.::|||||::||:||||:||.|.||||||||||||||
 Frog   123 DEQQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWR 187

  Fly   109 KAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHS 173
            :.|:|          |.:|.  ||.|                          ||:          
 Frog   188 RQEKL----------EVTSM--KLQD--------------------------SPI---------- 204

  Fly   174 HSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHTPLV 238
                                     ||.|:                  ||.||.|          
 Frog   205 -------------------------LSFNR------------------SPQPSAM---------- 216

  Fly   239 GGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPTP---TTPHAPQMPHSSAA 300
                   |:.|:              ||...|.:..|.:||.:....|   |:|  |.:|     
 Frog   217 -------SAISS--------------SLPLDSWLTPSISNSTALQSLPGFVTSP--PSLP----- 253

  Fly   301 AAAAFGSHIFGNFGGGSNASDSNCGFRPVLSEQSAVAAAAAAAAAQRSANHPPLFLPPHLAAQFT 365
                 ||:.                                          ||.|:.|   |...
 Frog   254 -----GSYT------------------------------------------PPPFINP---ASVG 268

  Fly   366 H--QPLFPGLKGVSPFQSLCSCCSLKPPPPP---GSSVVAPLSIPVSSSSAASSPESPKSSGQGS 425
            |  |||  |..|               ||||   |:|.|.  ..|:..:                
 Frog   269 HALQPL--GAMG---------------PPPPYQCGASFVD--KYPLEEA---------------- 298

  Fly   426 VHDPRSNSVAELRRKAQEHSAALLQSL 452
              |||:||:|.||.||:||    :||:
 Frog   299 --DPRNNSIASLRMKAKEH----IQSI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 38/51 (75%)
OAR 428..445 CDD:281777 11/16 (69%)
raxXP_002936715.1 Homeobox 135..188 CDD:365835 39/52 (75%)
OAR 299..315 CDD:367680 10/15 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4304
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.