DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and alx4a

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_001340966.1 Gene:alx4a / 100006399 ZFINID:ZDB-GENE-070712-3 Length:368 Species:Danio rerio


Alignment Length:236 Identity:85/236 - (36%)
Similarity:108/236 - (45%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKD 115
            |:||||||||..||||||..|.:||||||:.||.||::.:|||||||||||||||||||.||...
Zfish   174 KKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERFGQ 238

  Fly   116 EQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSH 180
            .|:.|.:..::..|          |.:|                 .|....|::.......|.:.
Zfish   239 MQQVRTHFSTAYEL----------PLLT-----------------RPENYAQIQNPSWIGGSSAA 276

  Fly   181 SRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHT-PLVGGGGQG 244
            |..||..:..||..:..|         ||..:.|..|...|.||| |.|..:.|. .|.|..|.|
Zfish   277 SPVPGCVVPCDSVTSCMP---------PHPHAASGVSDFLGVPSP-GSHMGQTHMGSLFGSPGMG 331

  Fly   245 PSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPT 285
            ........|.|...:.....:|    ||.|..:::|.|..|
Zfish   332 TGINGYDLNMDPDRKSSSIAAL----RMKAKEHSAAISWAT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 38/51 (75%)
OAR 428..445 CDD:281777
alx4aXP_001340966.1 Homeobox 179..231 CDD:278475 38/51 (75%)
OAR 344..361 CDD:281777 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.