DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and prop1

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001170932.2 Gene:prop1 / 100001377 ZFINID:ZDB-GENE-081107-40 Length:227 Species:Danio rerio


Alignment Length:213 Identity:71/213 - (33%)
Similarity:93/213 - (43%) Gaps:59/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLT 92
            |...||.|.|              :||:||||:.:|||.||.||.|.||||::.||:||....|.
Zfish    46 ARARPYPSPS--------------RRRHRTTFSNEQLEHLELAFRQNHYPDIYYREELARVTKLN 96

  Fly    93 EARVQVWFQNRRAKWRKAERLKDE----QRKRENGE-------SSSSLDKLHDSRESSPDITGEI 146
            |||:||||||||||.||.:|:..:    ......|.       |||::.:......|.|    .:
Zfish    97 EARIQVWFQNRRAKQRKQDRITQKSLAVSMMPVRGPLFSTMCVSSSAMGRQCQCPHSLP----HV 157

  Fly   147 DDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGMHLDSSDNERPLS-SNQLTATPHS 210
            ......|||  ..:.|           |..|.|...||.|.  |.|..|.:|.. .|||      
Zfish   158 PQFSPVLPP--GGYPP-----------HPSSGSQFSSPSGS--LPSQANRQPNDWYNQL------ 201

  Fly   211 ASQSLGSISAGSPSPSGM 228
              :::|      |||:.:
Zfish   202 --RNIG------PSPTSV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 34/51 (67%)
OAR 428..445 CDD:281777
prop1NP_001170932.2 Homeobox 59..112 CDD:278475 34/52 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.