DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34215 and CG2444

DIOPT Version :10

Sequence 1:NP_001097204.1 Gene:CG34215 / 5740170 FlyBaseID:FBgn0085244 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_572739.1 Gene:CG2444 / 32121 FlyBaseID:FBgn0030326 Length:114 Species:Drosophila melanogaster


Alignment Length:104 Identity:36/104 - (34%)
Similarity:54/104 - (51%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STV---LLAAIAVLLVSGY--EAAVVRGVFEDPTHPGKCVLE-GLVLEKGQSARHPQ-RCERIIC 61
            |||   ||..:.|:| .|:  :|||.:....:.:|||||||: ..:|..|::...|. .|.|..|
  Fly     5 STVAAFLLLGLVVIL-GGHVGQAAVAKVKLNNSSHPGKCVLDTNTILSPGETGLAPDLPCVRAEC 68

  Fly    62 GENSAAEIQSCGAYGLPPGKKFGKYTNPNADYPDCCNRE 100
            ..:.....::|.|...|||.|...:.|.|.::|.||.|:
  Fly    69 HADGLVTFKTCDAVAPPPGCKQRDFVNINREFPACCERK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34215NP_001097204.1 SVWC 37..99 CDD:464713 20/63 (32%)
CG2444NP_572739.1 SVWC 42..110 CDD:464713 21/66 (32%)

Return to query results.
Submit another query.