DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34427 and CG13309

DIOPT Version :9

Sequence 1:NP_001097553.2 Gene:CG34427 / 5740165 FlyBaseID:FBgn0085456 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_648262.2 Gene:CG13309 / 39012 FlyBaseID:FBgn0035933 Length:229 Species:Drosophila melanogaster


Alignment Length:279 Identity:75/279 - (26%)
Similarity:106/279 - (37%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VMVVLAFMVAQTVSDCNVCQSNQVACINSTSFYLCFGDGTPHRDQLYHCLEGFDCTNLTAICVQK 77
            :::||.|.:....:.||.|.:|.|:||:.|.|..|.....| ...||.|..|:.||..|.||...
  Fly     4 LLIVLGFYILGCRAACNTCNANGVSCISETEFQFCSSASEP-IGNLYTCPTGYYCTESTPICSSV 67

  Fly    78 SSQRPPSCGDTSQCGQCSANRNYLFACQSRGIFQMCYGATRP-TGQFGYCPTGTVCDASSTAICV 141
            :|    |.|.|. |..||::..  |||..|..|.:|.|.:.| |...|.|.|..||:..:..|| 
  Fly    68 AS----SAGCTG-CNTCSSDNR--FACTGRNTFALCLGTSTPSTSIGGSCGTNYVCNVGNANIC- 124

  Fly   142 PEVAGQTLTCDINDELVDTTTAASVTTETTGGTTESSTESTTESSTDSTVTTETPTTVTPLTPAQ 206
                |.           ..|.|.|.:|.:|.....::.::.||                      
  Fly   125 ----GS-----------PATYAVSCSTSSTSDCDTTAIKNATE---------------------- 152

  Fly   207 MCAQRNATGLFPVIPADPY-------CQRYISCY-----FQKNVLIKSAEYNCPTDSWF------ 253
            .|......|.:      ||       |::|::||     |..||      |.||..::|      
  Fly   153 YCQTIQTAGKY------PYGGDTSTTCRQYVNCYTAAGIFYGNV------YTCPGLTYFDSTSKL 205

  Fly   254 -VAQTQ-------SCVYVN 264
             ..|||       ||:.:|
  Fly   206 CTTQTQARCSDTVSCLTLN 224



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.