DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34427 and CG13311

DIOPT Version :9

Sequence 1:NP_001097553.2 Gene:CG34427 / 5740165 FlyBaseID:FBgn0085456 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_648258.1 Gene:CG13311 / 39008 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster


Alignment Length:154 Identity:54/154 - (35%)
Similarity:78/154 - (50%) Gaps:10/154 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVKGLVMVVLAFMVAQTVSD-CNVCQSNQVACINSTSFYLCFGDGTPHRDQLYHCLEGFDCTNLT 71
            :::.|.::|:...:|..|.. ||.||:|.|.|:|.|.:..|..:..|  :|:..|.:...||:|.
  Fly     6 ILRNLCLIVVVSSMAVLVQGVCNSCQANNVKCLNETHYSFCSDNVAP--NQVLQCPDNKVCTDLA 68

  Fly    72 AICVQKSSQRPPSCGDTSQCGQC-SANRNYLFACQSRGIFQMCYGATRPTGQFGYCPTGTVCDAS 135
            .||:. ||....||..|:. |.| :.:.|.:|.|.||..||||.| |..|||...|....:|...
  Fly    69 IICMD-SSVVDSSCSGTAD-GSCPTCDGNSMFVCTSRTTFQMCDG-TNLTGQVTKCKDNKICSIK 130

  Fly   136 STAICVP--EVAGQTLTCDINDEL 157
            |...||.  || |.::.||.:..|
  Fly   131 SGKYCVDLCEV-GDSVECDRDSPL 153



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471592
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.