DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34427 and CG32023

DIOPT Version :9

Sequence 1:NP_001097553.2 Gene:CG34427 / 5740165 FlyBaseID:FBgn0085456 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_729415.2 Gene:CG32023 / 317827 FlyBaseID:FBgn0052023 Length:160 Species:Drosophila melanogaster


Alignment Length:144 Identity:51/144 - (35%)
Similarity:67/144 - (46%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MVVLAFMVAQTVSD--CNVCQSNQVACINSTSFYLCFGDGTPHRDQLYHCLEGFDCTNLTAICVQ 76
            :|::::|....:.|  |||||.|.|.|:|.|.|..|.  .....||:..|.:|..||:|..||:.
  Fly    13 IVIISYMAVHVLGDIKCNVCQPNHVKCLNETHFSFCL--DAVSSDQVIQCPDGQVCTSLLKICLP 75

  Fly    77 KSSQRPPSCGDTSQ--CGQCSANRNYLFACQSRGIFQMCYGATRPTGQFGYCPTGTVCDASSTAI 139
            |.| .|.||...::  |..||...  ||.|.||..|||| ...:..||...|...|.|...|...
  Fly    76 KGS-TPASCTPDAEISCPPCSGAG--LFVCTSRTTFQMC-DEGKLIGQVTKCKDNTFCSMKSKKF 136

  Fly   140 CVPEVAGQTLTCDI 153
            ||.:       |:|
  Fly   137 CVDQ-------CEI 143



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.