DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34342 and Far1

DIOPT Version :9

Sequence 1:NP_001097509.3 Gene:CG34342 / 5740152 FlyBaseID:FBgn0085371 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001011933.1 Gene:Far1 / 293173 RGDID:1306647 Length:515 Species:Rattus norvegicus


Alignment Length:501 Identity:150/501 - (29%)
Similarity:254/501 - (50%) Gaps:58/501 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VTDFYSNATVLITGGTGFVGKVLTEKLLRSF-GLRKIYMLIRSKDNMSVQERLKGFFNESIFNRM 133
            :.::|....:|:||.|||:||||.||||||. .:..:|:|:|.|...:.|||::...:..:|:|:
  Rat     4 IPEYYEGKNILLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEILSGKLFDRL 68

  Fly   134 REESPQLLAKVHPIRADYSAIDLDIDSADRAMLSSEVQIVFNVVASVKFNEKLSDAIDINVLGTK 198
            |:|:|....|:..|.::.:...|.:...|:.::.....::|:..|:|:|||.|.||:.:||:.|:
  Rat    69 RDENPDFRQKIIAINSELTQPKLALSEEDKEIIIDSTNVIFHCAATVRFNENLRDAVQLNVIATR 133

  Fly   199 KILDLVMEMKHLKSFVHISTLYCNCNRKFIKEQVYENEIGYEKIMQIYRTFDDETLEKMRHCLIG 263
            :::.|..:||:|:.|:|:||.|..||||.|.|.||...:..:|::......||..:..:...|||
  Rat   134 QLILLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDSLEWMDDGLVNDITPKLIG 198

  Fly   264 QMPNTYTMTKKCAENLVNHRAFHMPAGIFRPPIVMSTYKDPFPGWTDNLYGPSGLCTWSARGLVR 328
            ..||||..||..||.:|......:...|.||.||.:::|:|||||.||..|||||...:.:|::|
  Rat   199 DRPNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPFPGWIDNFNGPSGLFIAAGKGILR 263

  Fly   329 CIYGKASCKANMVPADYVVNAMIATAWDIARRFKLRESKVDGKSELPVYNYVSDANN-ITWGQ-- 390
            .:....:..|::||.|.|||..:|.||         .|.|:....:.|||..:.:.| ..||:  
  Rat   264 TMRASNNALADLVPVDVVVNTSLAAAW---------YSGVNRPRNIMVYNCTTGSTNPFHWGEVG 319

  Fly   391 -YMHLSRKGFHEPFDKALWCFSYVIIPSKPL-----HCAIAFF------------LHNIPAYILD 437
             |::.|.|                   :.||     |..:.|:            .|.:||.:||
  Rat   320 DYLNHSFK-------------------TNPLNQVFRHPYVKFYSNNLMLHYWKGVKHTVPALLLD 365

  Fly   438 LIAMVTGQKRIYAKAYGKISRIIDMMAWFGLKEWKFAHRNIDELNELLPREERSVLQFNIATINW 502
            |...:||||....|...::.:.:..:.:|....|.:...|::.|...|..|::.....::..::|
  Rat   366 LALRLTGQKPWMMKTITRLHKAMVFLEYFTSNSWVWNTDNVNMLMNQLNPEDKKTFNIDVRQLHW 430

  Fly   503 SEYFRSYLSGIRRYFFKDSAND--------NKLQQRRTIYRRMLIL 540
            :||..:|..|.::|...:..:.        |||:..|..:..:|::
  Rat   431 AEYIENYCMGTKKYVLNEEMSGLPAARKHLNKLRNIRYGFNTILVI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34342NP_001097509.3 PLN02996 70..519 CDD:215538 145/470 (31%)
FAR-N_SDR_e 78..397 CDD:187547 116/323 (36%)
Sterile 429..519 CDD:281068 23/89 (26%)
Far1NP_001011933.1 PLN02996 2..446 CDD:215538 145/469 (31%)
FAR-N_SDR_e 11..330 CDD:187547 117/346 (34%)
Sterile 371..447 CDD:281068 17/75 (23%)
Necessary and sufficient for PEX19-mediated localization into peroxisome membrane. /evidence=ECO:0000250|UniProtKB:Q8WVX9 451..507 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D221518at33208
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11011
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X145
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.