DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpa2 and flr-2

DIOPT Version :9

Sequence 1:NP_001104054.3 Gene:Gpa2 / 5740142 FlyBaseID:FBgn0261386 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_505998.2 Gene:flr-2 / 186548 WormBaseID:WBGene00001466 Length:122 Species:Caenorhabditis elegans


Alignment Length:126 Identity:35/126 - (27%)
Similarity:50/126 - (39%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVLIC----CIPWLCDSNSMGKDAWLRPGCHKVGNTRKITIPDCVEFTITTNACRGFCESFSVP 66
            :.|:.|    |...:..:||          |.|||....|....|....|..|.|.|.|.||:.|
 Worm    17 VFVVTCLLQYCTAGVTKNNS----------CKKVGVEELIDEEGCDLMIIRINRCSGHCFSFTFP 71

  Fly    67 SIPMMGSSLSVLFKPPKPVVSV-GQCCNMMKSEEIQRRVLCIEGIRNVTFNSALSCSCYHC 126
            :             |.....|| .:||.|::.|.::..:.|.:|.||:...||..|.|:.|
 Worm    72 N-------------PLTKKYSVHAKCCRMVEWEMLETELKCSKGNRNLRIPSATQCECFDC 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpa2NP_001104054.3 None
flr-2NP_505998.2 GHB_like <36..116 CDD:389804 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159713
Domainoid 1 1.000 46 1.000 Domainoid score I8224
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4123
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435006at2759
OrthoFinder 1 1.000 - - FOG0007341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110189
Panther 1 1.100 - - LDO PTHR31129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.