Sequence 1: | NP_001104054.3 | Gene: | Gpa2 / 5740142 | FlyBaseID: | FBgn0261386 | Length: | 129 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011543076.1 | Gene: | GPHA2 / 170589 | HGNCID: | 18054 | Length: | 162 | Species: | Homo sapiens |
Alignment Length: | 136 | Identity: | 39/136 - (28%) |
---|---|---|---|
Similarity: | 63/136 - (46%) | Gaps: | 22/136 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGSSQLLVLICCIPWLCDSNSMGKDAWLRPGCH------KVGNTRKITIPDCVEFTITTNACRGF 59
Fly 60 CESFSVPSIPMMGSSLSVLFKP--PKPVVSVGQCCNMMKSEEIQRRVLCIEGIR-NVTFNSALSC 121
Fly 122 SCYHCK 127 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165147736 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1435006at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0007341 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_110189 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR31129 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.940 |