DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpa2 and GPHA2

DIOPT Version :9

Sequence 1:NP_001104054.3 Gene:Gpa2 / 5740142 FlyBaseID:FBgn0261386 Length:129 Species:Drosophila melanogaster
Sequence 2:XP_011543076.1 Gene:GPHA2 / 170589 HGNCID:18054 Length:162 Species:Homo sapiens


Alignment Length:136 Identity:39/136 - (28%)
Similarity:63/136 - (46%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSSQLLVLICCIPWLCDSNSMGKDAWLRPGCH------KVGNTRKITIPDCVEFTITTNACRGF 59
            |.|.|.|||...:  |..:.:.|::|.: ||||      .|.:.|:.|   | :.:....||.|.
Human    36 MASPQTLVLYLLV--LAVTEAWGQEAVI-PGCHLHPFNVTVRSDRQGT---C-QGSHVAQACVGH 93

  Fly    60 CESFSVPSIPMMGSSLSVLFKP--PKPVVSVGQCCNMMKSEEIQRRVLCIEGIR-NVTFNSALSC 121
            |||.:.|      |..|||...  ...:.||.|||.:...::::.::.|:...| .:...:|.:|
Human    94 CESSAFP------SRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARAC 152

  Fly   122 SCYHCK 127
            .|..|:
Human   153 QCDMCR 158



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435006at2759
OrthoFinder 1 1.000 - - FOG0007341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110189
Panther 1 1.100 - - LDO PTHR31129
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.