DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and cyth2

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:XP_005157903.1 Gene:cyth2 / 569358 ZFINID:ZDB-GENE-100921-55 Length:416 Species:Danio rerio


Alignment Length:111 Identity:29/111 - (26%)
Similarity:51/111 - (45%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 GWLHKQGSDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSVLLPSY--------RVSAC----LP 428
            |||.|.|. .:|.|::|||:|.:.||||::...:::..|.:.|.:.        |...|    :|
Zfish   281 GWLLKLGG-RVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYIP 344

  Fly   429 EDKIYRKFAFKCE------HQNMRTYWLAADNSEAMMQWVRALAAA 468
            .::.....|.|.|      ..|...|.::|...|...:|:.::.:|
Zfish   345 NNRGQLIKACKTEADGRVVEGNHMVYRISAPTPEEKDEWIHSIKSA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 29/111 (26%)
PH 372..469 CDD:278594 29/111 (26%)
cyth2XP_005157903.1 Sec7 78..260 CDD:279680
PH_GRP1-like 275..394 CDD:269954 29/111 (26%)
PH 279..392 CDD:278594 29/111 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.