DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and dapp1

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:XP_031755425.1 Gene:dapp1 / 548440 XenbaseID:XB-GENE-482064 Length:311 Species:Xenopus tropicalis


Alignment Length:175 Identity:42/175 - (24%)
Similarity:64/175 - (36%) Gaps:40/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 GSEHGTVYIQQNHPNHVVNQACQTQISAVKPKATPSSEESSSNSTKSPSHAPLDRKKSAGSIQAL 359
            |||.||: |...||                   .|.:.|..|.......|..:...:|...:   
 Frog   161 GSESGTL-ILLKHP-------------------YPCTVEEPSIYEAVRVHTAMQTGRSESDL--- 202

  Fly   360 KSPITKRPPSTPV--TLSGWLHKQGSDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSVLLPSYR 422
                   .|..|.  |..|:|.|||. .:|.|:.|||:|:...|.|:|..     |.:..:.:..
 Frog   203 -------VPVAPALGTKEGYLTKQGG-RVKSWKTRWFILSRNELKYFKDK-----LSTEPIKTLD 254

  Fly   423 VSAC--LPEDKIYRKFAFKCEHQNMRTYWLAADNSEAMMQWVRAL 465
            ::.|  :..|....|....|....:|||:|.|.......:|::.|
 Frog   255 LTECSAVQFDYSQEKVNCFCMVFPLRTYYLCAKTGAEADEWIKML 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 29/104 (28%)
PH 372..469 CDD:278594 27/98 (28%)
dapp1XP_031755425.1 SH2_DAPP1_BAM32_like 73..164 CDD:198218 2/2 (100%)
PH_DAPP1 208..303 CDD:269977 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.