DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and PLEK

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:NP_002655.2 Gene:PLEK / 5341 HGNCID:9070 Length:350 Species:Homo sapiens


Alignment Length:94 Identity:28/94 - (29%)
Similarity:40/94 - (42%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 GWLHKQGSDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSV-LLPSYRVSACLPEDKIYRKFAFK 439
            |:|.|:|| ....|:..|.||.|..:.:||...:....|.: |..|...|.|  :|...|.|.||
Human     9 GYLVKKGS-VFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPC--QDFGKRMFVFK 70

  Fly   440 CEHQNMRTYWLAADNSEAMMQWVRALAAA 468
            ......:.::..|...|....|||.:..|
Human    71 ITTTKQQDHFFQAAFLEERDAWVRDIKKA 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 28/94 (30%)
PH 372..469 CDD:278594 28/94 (30%)
PLEKNP_002655.2 PH1_Pleckstrin_2 3..110 CDD:270113 28/94 (30%)
PH 6..101 CDD:278594 28/94 (30%)
DEP_PLEK1 125..223 CDD:239892
PH2_Pleckstrin_2 239..346 CDD:270114
PH 245..347 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.