DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and akt2

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:NP_937789.1 Gene:akt2 / 378972 ZFINID:ZDB-GENE-031007-5 Length:479 Species:Danio rerio


Alignment Length:134 Identity:35/134 - (26%)
Similarity:60/134 - (44%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 VTLSGWLHKQGSDGLKVWRKRWFVL-AEYCLYYYKGPEEEKLLGSVLLPSYRVSAC---LPEDKI 432
            |...|||||:| :.:|.||.|:|:| ::.....||...|........|.::.|:.|   ..|...
Zfish     6 VVREGWLHKRG-EYIKTWRPRYFILKSDGSFIGYKEKPETSDANQPPLNNFSVAECQLMKTERPR 69

  Fly   433 YRKFAFKCEHQNM---RTYWLAADNSEAMMQWVRALAAASLMQAPSSGESEPSVNSSLNHSGENS 494
            ...|..:|.....   ||:.:  |::....:|:||:.|.:  ....|.|.:..::.:....|:||
Zfish    70 PNTFVIRCLQWTTVIERTFHV--DSNSEREEWIRAIQAVA--NGLKSREEDEPMDINFGSPGDNS 130

  Fly   495 DSGI 498
            ..|:
Zfish   131 LEGM 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 29/103 (28%)
PH 372..469 CDD:278594 29/103 (28%)
akt2NP_937789.1 PH_PKB 4..111 CDD:269947 29/109 (27%)
PH 6..106 CDD:278594 28/102 (27%)
S_TKc 150..407 CDD:214567
STKc_PKB_beta 154..476 CDD:173686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.