DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and DAPP1

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:NP_055210.2 Gene:DAPP1 / 27071 HGNCID:16500 Length:280 Species:Homo sapiens


Alignment Length:184 Identity:43/184 - (23%)
Similarity:65/184 - (35%) Gaps:58/184 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 GSEHGTVYIQQNHPNHVVNQACQTQISAVKPKATPSSEESSSNSTKSPSHAPLDRKKSAGSIQAL 359
            |||.||:.:.: ||                   .|...|..|.......|..:...::...:   
Human   116 GSETGTLMVLK-HP-------------------YPRKVEEPSIYESVRVHTAMQTGRTEDDL--- 157

  Fly   360 KSPITKRPPSTPV--TLSGWLHKQGSDGL-KVWRKRWFVLAEYCLYYYK---GPEEEKLLGSVLL 418
                   .|:.|.  |..|:|.|||  || |.|:.|||.|....|.|:|   .||..::|.    
Human   158 -------VPTAPSLGTKEGYLTKQG--GLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILD---- 209

  Fly   419 PSYRVSACLPEDKIYRKFAFKCEHQN-------MRTYWLAADNSEAMMQWVRAL 465
                ::.|...     :|.:..|..|       .||::|.|.......:|::.|
Human   210 ----LTECSAV-----QFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKIL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 32/113 (28%)
PH 372..469 CDD:278594 30/107 (28%)
DAPP1NP_055210.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH2_DAPP1_BAM32_like 28..119 CDD:198218 2/2 (100%)
PH_DAPP1 163..258 CDD:269977 30/107 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.