DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment kmr and AKT2

DIOPT Version :9

Sequence 1:	NP_001097775.2	Gene:	kmr / 5740131	FlyBaseID:	FBgn0085412	Length:	3090	Species:	Drosophila melanogaster
Sequence 2:	NP_001617.1	Gene:	AKT2 / 208	HGNCID:	392	Length:	481	Species:	Homo sapiens

Alignment Length:	134	Identity:	37/134 - (27%)
Similarity:	58/134 - (43%)	Gaps:	18/134 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   372 VTLSGWLHKQGSDGLKVWRKRWFVL-AEYCLYYYKGPEEEKLLGSVLLP--SYRVSAC---LPED 430
            |...|||||:| :.:|.||.|:|:| ::.....||  |..:.....|.|  ::.|:.|   ..|.
Human     6 VIKEGWLHKRG-EYIKTWRPRYFLLKSDGSFIGYK--ERPEAPDQTLPPLNNFSVAECQLMKTER 67

  Fly   431 KIYRKFAFKCEHQNM---RTYWLAADNSEAMMQWVRALAAASLMQAPSSGESEPSVNSSLNHSGE 492
            .....|..:|.....   ||:.:  |:.:...:|:||:.    |.|.|..:..|..:......|.
Human    68 PRPNTFVIRCLQWTTVIERTFHV--DSPDEREEWMRAIQ----MVANSLKQRAPGEDPMDYKCGS 126

  Fly   493 NSDS 496
            .|||
Human   127 PSDS 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
kmr	NP_001097775.2	PH_PEPP1_2_3	366..469	CDD:270068	29/105 (28%)
kmr	NP_001097775.2	PH	372..469	CDD:278594	29/105 (28%)
AKT2	NP_001617.1	PH_PKB	4..111	CDD:269947	32/113 (28%)
		STKc_PKB_beta	156..478	CDD:173686
		Inhibitor binding	230..232
		Inhibitor binding	277..279
		Inhibitor binding	292..293
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910