DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and Cnksr1

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:NP_001074516.1 Gene:Cnksr1 / 194231 MGIID:2670958 Length:700 Species:Mus musculus


Alignment Length:379 Identity:89/379 - (23%)
Similarity:148/379 - (39%) Gaps:94/379 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 VKPKATPSSEESSSNSTKSPSHAPLDRKKSAGSIQAL-KSPITKRPPSTPVTLSGWLHKQ----G 382
            |.|:.|....|||.:..|||.   |.||||.|....| :..::.|....| ...|||..:    |
Mouse   342 VLPEETAEPLESSGHPDKSPI---LGRKKSKGIATRLSRRRVSCRELGLP-DCDGWLLLRKVPGG 402

  Fly   383 SDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSVLLPSYRVSACLPEDKIYRKFAFKCEHQNMRT 447
            ..|.: ||:.||||..:.||:|:.|::||..|.:.|.:|.:.:...:.|   |:.|:..|...:.
Mouse   403 FMGPR-WRRCWFVLKGHTLYWYRQPQDEKAEGLINLSNYSLESGHDQKK---KYVFQLTHDVYKP 463

  Fly   448 YWLAADNSEAMMQWVRALAAA-----SLMQAPSSGESEPSVNSSLNHSGENSDSGIHTLQSHPGK 507
            :..||:....:.:|||.|...     :..:||||...|...:.:   ..|:.|....:..:.|| 
Mouse   464 FIFAAETLSDLSKWVRHLITCISKYQAQGRAPSSAREEDCYSET---EAEDPDEEAGSRSASPG- 524

  Fly   508 GQPTPSSENTGSSGGGSGSGQPLYANAPPKPRR--------INDGGYS---SPSPEHNEQQQQHP 561
              |..:..:|........|.:..:.::|....|        :..||.|   .|.|..:||.:...
Mouse   525 --PAQAWSDTSPVASPLQSPRTSFNSSPDSSDRALEGMVQGLRQGGVSLLGQPQPLTHEQWRSSF 587

  Fly   562 SRRLMSPTQQLYQQQQHQRSQQQQQQQPQQHHAIYDTRTGHVSTALQLQQAQQQYSLDHLEAQFQ 626
            .||...|                                 |::        ::.:.:..|::..:
Mouse   588 MRRNRDP---------------------------------HLN--------ERAHRIRALQSTLK 611

  Fly   627 QQQLDMEEQIARLQQQRAAEEIYGEREMYMAKLMQQRQGPNGTYPTQQQLLQAE 680
                      |:||:.:|.||:.|:.|:..||..|.::        |.|.|.:|
Mouse   612 ----------AKLQELQALEEVLGDPELTSAKFRQWKE--------QNQELYSE 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 32/111 (29%)
PH 372..469 CDD:278594 30/105 (29%)
Cnksr1NP_001074516.1 SAM_superfamily 4..70 CDD:301707
SAM 4..69 CDD:197735
CRIC_ras_sig 78..162 CDD:287501
PDZ_signaling 205..273 CDD:238492
PH_CNK_mammalian-like 376..489 CDD:269962 32/117 (27%)
PH 390..486 CDD:278594 30/99 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2051
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.