Sequence 1: | NP_001097775.2 | Gene: | kmr / 5740131 | FlyBaseID: | FBgn0085412 | Length: | 3090 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001171467.1 | Gene: | PHETA1 / 144717 | HGNCID: | 26509 | Length: | 262 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 52/205 - (25%) |
---|---|---|---|
Similarity: | 80/205 - (39%) | Gaps: | 46/205 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 371 PVTLSGWLHKQGSDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSVLLPSYRVSACLPEDKIYRK 435
Fly 436 FAFKCEHQNMRTYWLAADNSEAMMQWVRALAAASL--------------------------MQAP 474
Fly 475 SSGESEPSVNSSLNHSGENSDSGIHTLQSHPG---------KGQPTPSSENTGSSGGGSGSGQPL 530
Fly 531 YANAPPKPRR 540 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kmr | NP_001097775.2 | PH_PEPP1_2_3 | 366..469 | CDD:270068 | 32/97 (33%) |
PH | 372..469 | CDD:278594 | 31/96 (32%) | ||
PHETA1 | NP_001171467.1 | PH_Ses | 24..143 | CDD:270105 | 34/115 (30%) |
PH | 35..125 | CDD:278594 | 30/92 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |