DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and PHETA1

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:NP_001171467.1 Gene:PHETA1 / 144717 HGNCID:26509 Length:262 Species:Homo sapiens


Alignment Length:205 Identity:52/205 - (25%)
Similarity:80/205 - (39%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PVTLSGWLHKQGSDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSVLLPSYRVSACLPEDKIYRK 435
            ||..:|:|:|:|... ..:.:|||||....|:|::.....:.:|.::|....|.  |.|......
Human    30 PVDNAGFLYKKGGRH-AAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVE--LVEAAEEFA 91

  Fly   436 FAFKCEHQNMRTYWLAADNSEAMMQWVRALAAASL--------------------------MQAP 474
            ||.:......|||.|||::.:||..||:||:.||.                          ...|
Human    92 FAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQP 156

  Fly   475 SSGESEPSVNSSLNHSGENSDSGIHTLQSHPG---------KGQPTPSSENTGSSGGGSGSGQPL 530
            .|....||:.|:|        :.:.:|.|.|.         :....|..||..:......:.:|.
Human   157 QSLPLPPSLPSAL--------APVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPG 213

  Fly   531 YANAPPKPRR 540
            ....||.|||
Human   214 PEPPPPPPRR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 32/97 (33%)
PH 372..469 CDD:278594 31/96 (32%)
PHETA1NP_001171467.1 PH_Ses 24..143 CDD:270105 34/115 (30%)
PH 35..125 CDD:278594 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.