DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and AgaP_AGAP007379

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:XP_308452.4 Gene:AgaP_AGAP007379 / 1269802 VectorBaseID:AGAP007379 Length:383 Species:Anopheles gambiae


Alignment Length:217 Identity:51/217 - (23%)
Similarity:81/217 - (37%) Gaps:66/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 NDLQTPGSEHGT---VYIQQNHPNHVVNQ-----AC----QTQISAVKPKATPSSEESSSNSTKS 341
            |.||....:.||   :|:..:.| .|:|.     .|    :.||      |.||:.||.      
Mosquito   192 NSLQLTFMKEGTTRHIYVYHDDP-EVINNWYMAIRCAKLHRLQI------AYPSASESD------ 243

  Fly   342 PSHAPLDRKKSAGSIQALKSPITKRPPSTPVTLSGWLHKQGSDGLKVWRKRWFVLAEYCLYYYKG 406
                         .:..|....|:         .|||.|.|......:::|||.|.:..|.|:..
Mosquito   244 -------------LVDLLTHDFTR---------EGWLLKTGPRATDSYKRRWFTLDDRKLMYHDD 286

  Fly   407 -----PEEEKLLGSVLLPSYRVSACLP---EDKIYRKFAFKCEHQNMRTYWLAADNSEAMMQWVR 463
                 |:.|..||: .|..|.|....|   :|:.|....|..|    |.|.:::.:.:...:|:.
Mosquito   287 QLDAHPKGEIFLGN-QLDGYSVRIGAPPGAKDQGYSFTLFTPE----RVYNMSSHSEQDRDEWIA 346

  Fly   464 ALAAASLMQAPSSGESEPSVNS 485
            |:  .::::.|.|    |..||
Mosquito   347 AI--QNVLERPLS----PQDNS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 27/110 (25%)
PH 372..469 CDD:278594 27/104 (26%)
AgaP_AGAP007379XP_308452.4 ArfGap 6..123 CDD:279720
PH1_ADAP 130..237 CDD:270072 13/51 (25%)
PH 132..225 CDD:278594 9/33 (27%)
PH2_ADAP 251..354 CDD:241282 28/118 (24%)
PH 253..353 CDD:278594 28/115 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.