DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kmr and Plekha1

DIOPT Version :9

Sequence 1:NP_001097775.2 Gene:kmr / 5740131 FlyBaseID:FBgn0085412 Length:3090 Species:Drosophila melanogaster
Sequence 2:XP_006507203.1 Gene:Plekha1 / 101476 MGIID:2442213 Length:406 Species:Mus musculus


Alignment Length:183 Identity:53/183 - (28%)
Similarity:85/183 - (46%) Gaps:29/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 QTQISAVKPKATPSSEE---------SSSNSTKSPSHAPLDRKKSAGSIQALKSPITKRPPS-TP 371
            :|.|....|..||:.:|         ..:|..:|.||.|.               ...:||| :.
Mouse   142 RTDIVGGVPIITPTQKEEVNECGESLDRNNLKRSQSHLPY---------------FAPKPPSDSA 191

  Fly   372 VTLSGWLHKQGSDGLKVWRKRWFVLAEYCLYYYKGP-EEEKLLGSVLLPSYRVSACLPEDKIYRK 435
            |..:|:..|||: .:|.|::|:|.|.|..:.|:|.. |:|.|....|...::|..|...|.:.|.
Mouse   192 VIKAGYCVKQGA-VMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRD 255

  Fly   436 FAFKCEHQNMRTYWLAADNSEAMMQWVRALAAASLMQAPSSGESEPSVNSSLN 488
            ..|:.. ...||:::.||:.|.|..|::|::.|.:.|. ..|.|..||||:|:
Mouse   256 NLFEIV-TTSRTFYVQADSPEEMHSWIKAVSGAIVAQR-GPGRSSSSVNSNLS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kmrNP_001097775.2 PH_PEPP1_2_3 366..469 CDD:270068 33/104 (32%)
PH 372..469 CDD:278594 30/97 (31%)
Plekha1XP_006507203.1 PH1_TAPP1_2 1..117 CDD:270089
PH2_TAPP1_2 185..296 CDD:270090 35/113 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.