DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34454 and Spink4

DIOPT Version :9

Sequence 1:NP_001097457.1 Gene:CG34454 / 5740130 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001382679.1 Gene:Spink4 / 408233 RGDID:1303188 Length:86 Species:Rattus norvegicus


Alignment Length:86 Identity:25/86 - (29%)
Similarity:36/86 - (41%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TSIPISPTSANLVLVNNVRIPGGLTPFVPAPAPTKEFLNCFGNCPTTSQYNPICGSNMQLYMNEE 104
            |.:|:        |..:..:|......|.:..|..|.:..|.|||.:.  |.|||::...|.||.
  Rat    11 TLVPL--------LAMDRELPVSAARLVFSRMPICEHMAEFPNCPRSP--NLICGTDGLTYENEC 65

  Fly   105 KFNCARF-CGADIQIVRRGSC 124
            .....|. ...||||::.|.|
  Rat    66 HLCVTRMKTKKDIQIMKDGKC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34454NP_001097457.1 Surface_antigen 29..>76 CDD:287966 6/35 (17%)
KAZAL_FS 78..124 CDD:294071 17/46 (37%)
Spink4NP_001382679.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21179
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.