DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34334 and trv

DIOPT Version :10

Sequence 1:NP_001097042.1 Gene:CG34334 / 5740122 FlyBaseID:FBgn0263829 Length:708 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:53 Identity:14/53 - (26%)
Similarity:21/53 - (39%) Gaps:13/53 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ITVPIYILIVTY--------ADIPSTL---DARCTSDDFPPCNGNYYCPRGAA 237
            |.|.|.|::|.|        |.:||.:   :.|..|  .....|.:..|..:|
  Fly   151 IDVDIRIMLVNYFGSVALTKACLPSMMARKEGRIVS--ISSVQGKFAIPHRSA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34334NP_001097042.1 Herpes_BLLF1 <312..504 CDD:282904
RRM_RNPS1 537..610 CDD:409800
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:409789
RRM3_TIA1_like 416..489 CDD:409790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.