DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and GLC7

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_011059.3 Gene:GLC7 / 856870 SGDID:S000000935 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:170/293 - (58%)
Similarity:221/293 - (75%) Gaps:3/293 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LDEMIASLL---SWKIDRKMMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLL 78
            :|.:|..||   ..|..:::.:.|::|..|..:||.:.:.:|:||.:|||:.:.|||||||.|||
Yeast     8 VDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLL 72

  Fly    79 RYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYD 143
            |.||..|.||:..||.|||||||||.|:||:.||||||::||.:..:||||||.|:|||.|||||
Yeast    73 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYD 137

  Fly   144 ECKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCD 208
            |||||:.|:||:.|.||::|||:||||:.||||.||||||.|:::..|:.:.||.::...|||||
Yeast   138 ECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCD 202

  Fly   209 LLWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFS 273
            |||||||...:||.:|.||||||||.|:|..||.:...:||||||||||||||||:||||:|:||
Yeast   203 LLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFS 267

  Fly   274 AVNYCGEFDNAGAMMCVDAELNITLVVMKPKKR 306
            |.|||||||||||||.||..|..:..::||.::
Yeast   268 APNYCGEFDNAGAMMSVDESLLCSFQILKPAQK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 168/288 (58%)
PP2Ac 36..305 CDD:197547 165/268 (62%)
GLC7NP_011059.3 MPP_PP1_PPKL 7..297 CDD:277359 168/288 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.