DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and ppp1cb

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001011467.1 Gene:ppp1cb / 496958 XenbaseID:XB-GENE-961670 Length:327 Species:Xenopus tropicalis


Alignment Length:298 Identity:176/298 - (59%)
Similarity:224/298 - (75%) Gaps:3/298 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EKYLDEMIASLLSWKIDRK---MMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYN 75
            |..:|.:|:.||..:..|.   :.:.|:::..|..::|::.:|:|:||.:|||:.:.|||||||.
 Frog     5 ELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYT 69

  Fly    76 DLLRYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYG 140
            ||||.||..|.||:..||.|||||||||.|:||:.||||||::||.:..|||||||.|:|||.||
 Frog    70 DLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYG 134

  Fly   141 FYDECKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGL 205
            |||||||||.|:||:.|.||::|||:|||::.|||||||||||.|.::..|:.:.||.:|...||
 Frog   135 FYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGL 199

  Fly   206 LCDLLWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLIT 270
            ||||||||||....||.:|.||||||||.|:|..||:|...||||||||||||||||||||||:|
 Frog   200 LCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVT 264

  Fly   271 VFSAVNYCGEFDNAGAMMCVDAELNITLVVMKPKKRIA 308
            :|||.||||||||||.||.||..|..:..::||.::.|
 Frog   265 LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 172/288 (60%)
PP2Ac 36..305 CDD:197547 169/268 (63%)
ppp1cbNP_001011467.1 MPP_PP1_PPKL 7..297 CDD:277359 172/289 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.