DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:280 Identity:125/280 - (44%)
Similarity:175/280 - (62%) Gaps:7/280 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SWKIDR-KMMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFETSGHP-- 87
            ||.... :.:..|.:||::..:||:....|||.|.:||||.:.||||||:.|||..|:..|.|  
 Worm    26 SWSPGNCQTLFQEKEIIEICYRAREAFWKEPMKLEIEAPVTICGDIHGQFEDLLSMFDIYGFPHV 90

  Fly    88 ----PKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRR 148
                ...|||.||||:|||.:|:|.:|||.||::.:|..:.||||||||..:|..||||:|||||
 Worm    91 SQKDKSSRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHESRPVNMQYGFYNECKRR 155

  Fly   149 FTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSD 213
            :::.|:..|...:.|:|:.||:..:|.|.|||:...|.:|..|...|||.::...|:..||.|:|
 Worm   156 YSVTLYETFQWAFYCMPLCAIVGGRIMCMHGGIPFGLLSLEQIDEFQRPTDIADVGIPSDLCWAD 220

  Fly   214 PDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVNYC 278
            |....:|::.:.||....||...|:.|..:|..|||.||||||.|||||||.::|:|:|||..||
 Worm   221 PVSGVVGFQDSPRGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFADKKLVTIFSAPCYC 285

  Fly   279 GEFDNAGAMMCVDAELNITL 298
            |.|||.||::.|...:..|:
 Worm   286 GHFDNLGAVLQVATNMECTI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 125/280 (45%)
PP2Ac 36..305 CDD:197547 123/269 (46%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 123/270 (46%)
MPP_superfamily 36..304 CDD:301300 122/267 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.