DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:290 Identity:174/290 - (60%)
Similarity:219/290 - (75%) Gaps:3/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LDEMIASLLSWKIDR---KMMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLL 78
            ||.:|..||..:..|   .:.:.|::|..|..::|::.:|:|:||.:|||:.:.|||||||.|||
  Rat     9 LDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 73

  Fly    79 RYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYD 143
            |.||..|.||:..||.|||||||||.|:||:.||||||::||.:..|||||||.|:|||.|||||
  Rat    74 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 138

  Fly   144 ECKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCD 208
            |||||:.|:||:.|.||::|||:|||::.|||||||||||.|.::..|:.:.||.:|...|||||
  Rat   139 ECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCD 203

  Fly   209 LLWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFS 273
            |||||||....||.:|.||||||||.::|..||.:...||||||||||||||||||||||:|:||
  Rat   204 LLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFS 268

  Fly   274 AVNYCGEFDNAGAMMCVDAELNITLVVMKP 303
            |.|||||||||||||.||..|..:..::||
  Rat   269 APNYCGEFDNAGAMMSVDETLMCSFQILKP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 172/288 (60%)
PP2Ac 36..305 CDD:197547 168/268 (63%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 172/288 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.