DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and Y69E1A.4

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_502041.1 Gene:Y69E1A.4 / 190550 WormBaseID:WBGene00013476 Length:375 Species:Caenorhabditis elegans


Alignment Length:347 Identity:131/347 - (37%)
Similarity:192/347 - (55%) Gaps:58/347 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KYLDEMIASLLSWKIDRKM-MVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLL 78
            |.|::::   ..|.....| :...:::.:|..:||:::.|||:.|.:|||:.|:||||||::|||
 Worm    18 KILEKIV---FKWTHKTSMDLFCAAELAELCHRARELIWSEPIFLKLEAPICVMGDIHGQFDDLL 79

  Fly    79 RYFETSGHP--------------------------------------------PK---------- 89
            ...:.:|.|                                            ||          
 Worm    80 AMLDMNGWPLSSQEFEALKDTTVRSRETGKRPQSEPHSTQPESSNDVKPPVAAPKSVNKEVTTGY 144

  Fly    90 KRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRFTIRLW 154
            ||||.||||||||.:|:|.:.||.|.|:.||..|:||||||||.::|..||||.|...|:..:|:
 Worm   145 KRYLFLGDYVDRGPFSMEVVILLTALKLAYPDRIYLLRGNHESRSVNTSYGFYREVNYRYDAQLY 209

  Fly   155 RMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSDPDPTAI 219
            ..|.:.::..|..|:||:.|.|.|||:|..|.:.|.....:||.|:...|:|.||.|:|||||..
 Worm   210 ECFQNMFNVFPFCAVINNTIMCMHGGISEHLTSFNQFSVFKRPLEIPDVGVLTDLTWADPDPTEK 274

  Fly   220 GWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVNYCGEFDNA 284
            |::.::||.||.||...:..||.:....::.|.|||||||||||..|:|:|:|||.||||:.||.
 Worm   275 GYKPSARGASFVFGPPALRAFLKKLDLQMVIRGHQVVEDGYEFFDGRRLVTIFSAPNYCGQNDNT 339

  Fly   285 GAMMCVDAELNITLVVMKPKKR 306
            .|:..:|.:|.|::.|.:|:.|
 Worm   340 AAVFSIDKKLKISINVFRPESR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 128/340 (38%)
PP2Ac 36..305 CDD:197547 126/322 (39%)
Y69E1A.4NP_502041.1 PP2Ac 36..360 CDD:197547 126/323 (39%)
MPP_superfamily 39..358 CDD:301300 125/318 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.