DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and F44B9.9

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:277 Identity:83/277 - (29%)
Similarity:124/277 - (44%) Gaps:74/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFET--SGHPPK---------K 90
            ::::..||....::...|..|..:..||.::||||||:.||:|...|  |....|         |
 Worm     6 KTELFCLLDMVIELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGFSTK 70

  Fly    91 RYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRFTIRLWR 155
            :::.||||||||..|::.:.|:.:.|:.:|....|||||||:.|||..|||              
 Worm    71 KWVFLGDYVDRGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF-------------- 121

  Fly   156 MFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLWSDPDPTAIG 220
                     .|.:::..||                      ||:                |:.| 
 Worm   122 ---------RVCSVVVLKI----------------------PAK----------------PSFI- 138

  Fly   221 WEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVNYCGEFDNAG 285
             ..|.||:|..|....|.......:..||.|.||::..|::|||.|:|.|:|||..|..|.||:|
 Worm   139 -RNNKRGLSVCFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEIDNSG 202

  Fly   286 AMMCVDAELNITLVVMK 302
            |:|.|.:...|::.:||
 Worm   203 AVMKVASNGKISISIMK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 83/277 (30%)
PP2Ac 36..305 CDD:197547 83/277 (30%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.