DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and C24H11.2

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_499528.1 Gene:C24H11.2 / 182860 WormBaseID:WBGene00007700 Length:384 Species:Caenorhabditis elegans


Alignment Length:319 Identity:132/319 - (41%)
Similarity:180/319 - (56%) Gaps:31/319 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LDEMIASLLSWKIDRKMMVPESDIIKLLKQARQVLMSEP------------------------ML 57
            |.:||..||.....:.:|..|.:|..||.:..:...|.|                        .|
 Worm    43 LTDMIKKLLKPVFSKAIMFDEKEIHVLLTRVFKYYTSPPNKKTAPSASASATTSMSPPKPAANAL 107

  Fly    58 LTVEAPVNVLGDIHGQYNDLLRYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTS 122
            |.::||:|:.||.|||||||||.|...|...|.:||.||||||||.:|:|.:.||.:.|:..|..
 Worm   108 LELQAPINICGDTHGQYNDLLRIFNACGAATKTQYLFLGDYVDRGGHSLEVIMLLFSLKLAMPRK 172

  Fly   123 IHLLRGNHESAAINRYYGFYDECKRRFTIR-----LWRMFVDCYDCLPVAAIINSKIFCCHGGLS 182
            :||||||||..|||:.|||:.|.|:||...     ::..|...:..:|:.||::.:|.|.|||:|
 Worm   173 MHLLRGNHELKAINKNYGFHAELKKRFQREEVYESVYNHFNQVFSYMPLCAIVSKRILCMHGGIS 237

  Fly   183 PSLHNLNDIQHLQRPAEVDR-NGLLCDLLWSDPDPTAIGWEKNS-RGVSFTFGVDIVETFLSRFS 245
            |.|.:|:||:.:..|.|..: :.|.|||||:||:..|.|:|.|. |.:|..||...|:....|..
 Worm   238 PHLKSLDDIRAIPLPLETAKTHPLACDLLWADPEKDAKGFEPNKIRAISNVFGKKEVDDLCKRLD 302

  Fly   246 FDLICRAHQVVEDGYEFFAKRQLITVFSAVNYCGEFDNAGAMMCVDAELNITLVVMKPK 304
            .|||.|||||||.||.|||.|:|||||||..|..|..|..|::.|:..|.::.|.:||:
 Worm   303 IDLIVRAHQVVEYGYAFFADRRLITVFSASRYQIELCNYAAVVVVNKMLELSFVQLKPE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 130/316 (41%)
PP2Ac 36..305 CDD:197547 126/300 (42%)
C24H11.2NP_499528.1 MPP_superfamily 43..360 CDD:301300 130/316 (41%)
PP2Ac 106..360 CDD:197547 118/253 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.