DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and C23G10.1

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001367544.1 Gene:C23G10.1 / 175880 WormBaseID:WBGene00016010 Length:454 Species:Caenorhabditis elegans


Alignment Length:305 Identity:124/305 - (40%)
Similarity:180/305 - (59%) Gaps:14/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QMFEKYLDE--------MIASLLSWKIDRKMMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVL 67
            :||:|..||        .|.:||:.|...|  :...||.:|:...:::...:..::.::.||.:.
 Worm   132 KMFQKQSDESNKMFAEHFIKTLLACKGMTK--IRTMDIFRLIHICKKIFTVQKSMVEIDGPVRIC 194

  Fly    68 GDIHGQYNDLLRYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHES 132
            ||:||||.||:|.|...|.||...||.||||||||.:::|.:.|.||||.|||.:..:||||||.
 Worm   195 GDLHGQYPDLIRLFAQGGFPPDSNYLFLGDYVDRGSFNLEVILLCLAYKARYPNNFMMLRGNHEV 259

  Fly   133 AAINRYYGFYDEC---KRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHL 194
            ..||..|||.||.   |..:...|:..|.:..|.:|:.|::..:|.|.|||||..:.:|:|:::|
 Worm   260 IHINEKYGFKDEVFNRKGEYHDELYPEFNEMMDMMPLVALVGGRILCMHGGLSQHIKSLDDLRNL 324

  Fly   195 QRPAEVDRNGLLCDLLWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDG 259
            :||...:...|..|::||||...: ||..|.||.|..||.:.|:........|||.|.||||:||
 Worm   325 RRPFHSEDECLENDIMWSDPAKVS-GWTANPRGASVQFGENEVKEMCKLLDIDLIVRGHQVVQDG 388

  Fly   260 YEFFAKRQLITVFSAVNYCGEFDNAGAMMCVDAELNITLVVMKPK 304
            |||||.::|:|||||.:|...|.|:.|:..|.|.|.::..|:||:
 Worm   389 YEFFAGKKLVTVFSAPHYMQSFTNSAAVCKVSAGLEVSFEVLKPE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 119/296 (40%)
PP2Ac 36..305 CDD:197547 114/272 (42%)
C23G10.1NP_001367544.1 PP2Ac 162..432 CDD:197547 112/270 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.