DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and R03D7.8

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_496359.2 Gene:R03D7.8 / 174684 WormBaseID:WBGene00010992 Length:596 Species:Caenorhabditis elegans


Alignment Length:268 Identity:76/268 - (28%)
Similarity:126/268 - (47%) Gaps:13/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYFETSGHPPKKRYLMLGDYVDRGK 103
            :::.|.::....:..||.||.:||.:.|:|||.|:|.||.|:.:.:|.||..|.|.||..:|.|:
 Worm   335 ELLCLFEETAFKMAEEPSLLQIEADITVIGDIRGRYADLHRWLQLTGWPPHNRILFLGGILDSGE 399

  Fly   104 Y-SVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECKRRFTIRLWRMFVDCYDC--LP 165
            . |||.|.|:.:.|.|:|..:.:|||..|::........:....|.....:.||      |  :|
 Worm   400 SGSVECLALICSLKCRFPKHVFILRGEPETSPFRMSTRLHPVITRAVQSCIKRM------CTHMP 458

  Fly   166 VAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDR-NGLLCDLLWSDPDPTAIGWEKNSRGVS 229
            .||||...:...:.|.||.:.....|.||.||...:. |.:...::::.|......:..|.....
 Worm   459 FAAIIGKSVLAVYSGFSPMIREKGHIHHLFRPVTAEHMNAVERHIIFNQPSNRVRMYRPNPNTEG 523

  Fly   230 FTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVNYCGEFDNAGAMMCVDAEL 294
            ..||...|:........:::.|....|..||......:||.::||..|..:|   ||::.:..:|
 Worm   524 DWFGKQAVKRACKATRCNVMIRGQSYVPYGYLPCWNNRLINLWSAPGYGSDF---GAILSISKDL 585

  Fly   295 NITLVVMK 302
            .||.::|:
 Worm   586 VITPILME 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 76/268 (28%)
PP2Ac 36..305 CDD:197547 76/268 (28%)
R03D7.8NP_496359.2 MPP_superfamily 334..595 CDD:387346 76/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.