DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y1 and C06A1.3

DIOPT Version :9

Sequence 1:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_496276.1 Gene:C06A1.3 / 174626 WormBaseID:WBGene00007354 Length:364 Species:Caenorhabditis elegans


Alignment Length:307 Identity:129/307 - (42%)
Similarity:188/307 - (61%) Gaps:4/307 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKWFFRFQYQMFEKYLDEMIASLLSWKIDRKM----MVPESDIIKLLKQARQVLMSEPMLLTVE 61
            :||:....:.....:::|:.|..:.|...|..:    ::...:||.:::....:.|.|..|...|
 Worm    21 ISKFDLAKENPKLAEWMDDCIKRMNSLYKDTNINICNVMTGHEIISIIRMVEAIFMEESNLCEAE 85

  Fly    62 APVNVLGDIHGQYNDLLRYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLL 126
            ||:.|:||||.||.|:.|.|:..|..|:::.:.||||||||...:|.|.||...|:||...|:||
 Worm    86 APIKVIGDIHAQYQDMNRLFDLIGRVPEEKLMFLGDYVDRGPQGIEVLILLFCLKIRYRDRIYLL 150

  Fly   127 RGNHESAAINRYYGFYDECKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDI 191
            |||||:.::|:.||||.||:.::.|.||..|..|::.:|::.:|:.::.|.||||||.|.||:.|
 Worm   151 RGNHETPSVNKIYGFYVECQYKYGIGLWWDFQSCFNRMPMSGLISKRVLCMHGGLSPELINLDTI 215

  Fly   192 QHLQRPAEVDRNGLLCDLLWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVV 256
            :::.||.|....|||.|||||||.....||..:.||:|:.||..:||........|||.||||||
 Worm   216 RNIPRPCEPLDRGLLIDLLWSDPTNKGEGWFHSIRGISYMFGKGVVEQACKSLEIDLIIRAHQVV 280

  Fly   257 EDGYEFFAKRQLITVFSAVNYCGEFDNAGAMMCVDAELNITLVVMKP 303
            :||||....|:||||||..|||.:|.||.|::|::|.|.|:...|.|
 Worm   281 QDGYEMMTGRRLITVFSVPNYCAQFTNAAAVVCLNANLQISFQQMIP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 126/289 (44%)
PP2Ac 36..305 CDD:197547 123/268 (46%)
C06A1.3NP_496276.1 MPP_superfamily 37..327 CDD:301300 126/289 (44%)
PP2Ac 59..329 CDD:197547 123/269 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.