DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34459 and CG14354

DIOPT Version :9

Sequence 1:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_651433.1 Gene:CG14354 / 43120 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster


Alignment Length:205 Identity:91/205 - (44%)
Similarity:132/205 - (64%) Gaps:2/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NSKSASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEAQSAAGQAAAQHIKMELA 155
            |.:.:.::..|..|...:.  |..|:.||.:|.||.||||:||.||:.|:.|..|||:.:|.:||
  Fly    37 NQQQSRSQLLDQSADLTMG--IRQGNSKQTASNIAQKAAQEAKKASDTQAPAALAAARQVKHQLA 99

  Fly   156 EKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEESNSIHHTEANMNAAVEAVKVAVQQFET 220
            |||..:||||||||.|||.:::||:.||.||..:|:||:.|:..::.|:|.||...|......::
  Fly   100 EKAIAAAKAAEAALAGKQQLMEQLQDEVHEAEIIVQEETYSLVGSQTNVNVAVATAKQCQTLLQS 164

  Fly   221 INELQKTARESLTNIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKTKQAAYKAA 285
            :....|.|.|:::|.:..|.|:|||:..|.||:|.||.|..||.:||.||..||..|::|||:||
  Fly   165 LRSSVKVAEEAVSNAEAAASGAQQELCEKNQLVETARQRAEMLMQQLRSAKLDYTNTRKAAYRAA 229

  Fly   286 CAAVEAKQRA 295
            |||.||:.:|
  Fly   230 CAANEARNKA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 86/179 (48%)
CG14354NP_651433.1 DUF745 59..239 CDD:283087 86/179 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.