DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34459 and CG11698

DIOPT Version :9

Sequence 1:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649787.2 Gene:CG11698 / 40986 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster


Alignment Length:219 Identity:76/219 - (34%)
Similarity:115/219 - (52%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TAPGPGTDNSKSASNKQCDPQAKCNVKTIITPGD----PKQKSSMIAMKAAQDAKAASEAQSAAG 143
            ||..|...|         ||:.|        ||.    ...|:|.:|.|||:|||.|.:||..|.
  Fly    26 TAAHPAQRN---------DPRFK--------PGSLPCKTSMKASQVASKAAKDAKDAKDAQPCAA 73

  Fly   144 QAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEESNSIHHTEANMNAAV 208
            :.|....:..||::|.|:||||||||.||:.::|:..:.:.|.:.|:||...:|   .|:..:|.
  Fly    74 EMAGYRAREMLADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQRAI---AASSCSAT 135

  Fly   209 EAVKVAVQQFETINELQKTARE---SLTNIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVSA 270
            .|..:..:...::|.::...:|   :|.||:.:|..:|:|...|..||:|||.|:..|...:..|
  Fly   136 SAKGIRDKLCTSVNIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEA 200

  Fly   271 HDDYEKTKQAAYKAACAAVEAKQR 294
            ..|.|:.||:|.||..||.||:||
  Fly   201 QKDLERNKQSAKKANDAAKEAQQR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 68/187 (36%)
CG11698NP_649787.2 DUF745 45..225 CDD:283087 67/183 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.