DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34459 and CG11694

DIOPT Version :9

Sequence 1:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 / 40985 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster


Alignment Length:287 Identity:113/287 - (39%)
Similarity:154/287 - (53%) Gaps:55/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YLMFLRLLLHCTTGHTLPQRHSPQHKRMIDPRELLNDFAAIKEPGTSEVAPKNSARSIALYNAGG 74
            :|:|.....| :.||.|||..              |:.||:                        
  Fly     8 FLLFFLFSDH-SAGHKLPQSS--------------NEIAAL------------------------ 33

  Fly    75 AMSG-SGEGTAPGPGTDNSKSASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEA 138
             ||. .|:|       |||.|:|:.......|.|.||       :.|:|.||.|||::|..||:|
  Fly    34 -MSDHHGDG-------DNSVSSSSGGAPCDFKMNGKT-------RVKASCIAQKAAKEAMEASDA 83

  Fly   139 QSAAGQAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEESNSIHHTEAN 203
            |..||:|||:.:|.:||:||..:||||||||.|||.:|:|||.||:|...||:|||..:..|:..
  Fly    84 QIEAGEAAARQVKQQLADKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTT 148

  Fly   204 MNAAVEAVKVAVQQFETINELQKTARESLTNIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLV 268
            ..||.:|.|.|..|..||....|.|::::.|.:.||.|:|||:..|.||:|||:.|:.:|.:||.
  Fly   149 YAAAGQAAKQAADQLNTITLAVKNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLE 213

  Fly   269 SAHDDYEKTKQAAYKAACAAVEAKQRA 295
            .|..|::.||.||.||||||.||:.||
  Fly   214 VARVDFKNTKNAAEKAACAAQEARHRA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 87/179 (49%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 30/74 (41%)
DUF745 60..223 CDD:283087 77/169 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.