DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34459 and CG11693

DIOPT Version :9

Sequence 1:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001246985.1 Gene:CG11693 / 40984 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster


Alignment Length:278 Identity:70/278 - (25%)
Similarity:117/278 - (42%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PQRHS----PQHKRMIDPRELLNDFAAIK----EPGTSEVAP-KNSARSIALYNAGGAMSGSGEG 82
            |..|.    ||...:|:.......:.||.    ||...:::. :.|:..|...:.||...|||  
  Fly    44 PSPHGPGPVPQQTAVIEHEVPPYTYEAINHDEFEPAKVKLSHFEGSSDYIVHSHRGGGGGGSG-- 106

  Fly    83 TAPGPGTDNSKSASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEAQSAAGQAAA 147
               |...||...:                            ||..:|..|.:|..:|:|||:.|:
  Fly   107 ---GYLADNGLRS----------------------------IAKGSADQALSAVASQNAAGKQAS 140

  Fly   148 QHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEESNSIHHTEANMNAAVEAVK 212
            ...|..||:.|.|:|..|.|.|.||::::.:||.:..||...:|.|...:...:.:..||..|.:
  Fly   141 YVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELTQLQQAKRSAKAAQYAAQ 205

  Fly   213 VAVQQFETINELQKTARESLTNIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKT 277
            .|:.....:......|:.:....|..|..:..|:|::..::..|:.::...:.|..:|..|||:|
  Fly   206 QAINHVSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKTKLEHAESQAYAARLDYEET 270

  Fly   278 KQAAYKAACAAVEAKQRA 295
            :.||.||..:|.||...|
  Fly   271 RDAAEKATLSAQEAHLNA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 50/179 (28%)
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 52/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.