DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34459 and CG33257

DIOPT Version :9

Sequence 1:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster


Alignment Length:322 Identity:82/322 - (25%)
Similarity:139/322 - (43%) Gaps:88/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IRGVLAMYLMFLRL-----LLHCTTG-HTLPQRHSPQHK-RMIDPRELLNDFAAIKEPGTSEVAP 60
            :|.:||..::.|.|     .||...| |..||:..|.|: ...:|.     ..|::.|...:  |
  Fly     6 LRFLLAQLVLVLLLSNALGRLHKRNGYHYRPQQPPPIHQGGYFEPH-----LPAVEPPEPEK--P 63

  Fly    61 KNSARSIALYNAGGAMS-----GSGEGTAPGPGTDNSKSASNKQCDPQAKCNVKTIITPGDPKQK 120
            ::|.:|  .|...|..|     ||| |.:.|.|..:                             
  Fly    64 QHSTKS--YYTTSGGSSSVSSKGSG-GYSIGSGLRS----------------------------- 96

  Fly   121 SSMIAMKAAQDAKAASEAQSAAGQAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQE 185
               ||..:|..|.:|...|.||.:.||...:..||:.|.|:|..|:|||:|||:::.:|||:..|
  Fly    97 ---IAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQAAATAQAALVGKQVVLQELEQQAAE 158

  Fly   186 A-----------------SAVVEEESNSIHHTEANMNAAVEAVKVAVQQFETINELQKTARESLT 233
            |                 :.:.::.:.:.||..:.:.|||...|...:|          |.::.|
  Fly   159 AQRSLSRELEQLKAAKISARLAQQTAQAAHHHISVLTAAVNNAKSVAEQ----------AEQTST 213

  Fly   234 NIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKTKQAAYKAACAAVEAKQRA 295
            .:       ..::|:::|::..::||:..:::||..|..||..||::|.|||.:|..|:..|
  Fly   214 EV-------NNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALKAANSAAAAQVNA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 53/196 (27%)
CG33257NP_996107.1 DUF745 94..252 CDD:283087 46/206 (22%)
SNARE 195..240 CDD:304603 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.