| Sequence 1: | NP_000951.1 | Gene: | PTGIR / 5739 | HGNCID: | 9602 | Length: | 386 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024805.1 | Gene: | tyra-3 / 187427 | WormBaseID: | WBGene00006475 | Length: | 592 | Species: | Caenorhabditis elegans |
| Alignment Length: | 259 | Identity: | 61/259 - (23%) |
|---|---|---|---|
| Similarity: | 93/259 - (35%) | Gaps: | 67/259 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Human 22 LMFVAGVVGNGLALGILSARRPARPSAFA-VLVTGLAATDLLGTSFLSPAVFVAYARNSSLLGLA 85
Human 86 RG-----GPALCDAFAFAMTFFGLASMLILFAMAVERCLALSHPYLYAQLDGPRCARLALPAIYA 145
Human 146 FCVLFCALPLLGLGQHQQYCPGSW-CFLRMRWAQPGGAAFSLAYAGLVALLVAAIFLCNGSVTLS 209
Human 210 L---------------------------CRMYR-----QQKRHQGSL----GPRPRTGEDEVDH 237 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PTGIR | NP_000951.1 | 7tm_GPCRs | 14..304 | CDD:333717 | 61/259 (24%) |
| TM helix 1 | 16..40 | CDD:320095 | 4/17 (24%) | ||
| TM helix 2 | 50..72 | CDD:320095 | 8/22 (36%) | ||
| TM helix 3 | 93..115 | CDD:320095 | 5/21 (24%) | ||
| TM helix 4 | 138..154 | CDD:320095 | 4/15 (27%) | ||
| TM helix 5 | 181..204 | CDD:320095 | 6/22 (27%) | ||
| TM helix 6 | 235..260 | CDD:320095 | 2/3 (67%) | ||
| TM helix 7 | 271..296 | CDD:320095 | |||
| tyra-3 | NP_001024805.1 | 7tmA_tyramine_R-like | 101..>300 | CDD:320189 | 50/214 (23%) |
| TM helix 1 | 102..126 | CDD:320189 | 5/19 (26%) | ||
| TM helix 2 | 135..157 | CDD:320189 | 8/30 (27%) | ||
| TM helix 3 | 174..196 | CDD:320189 | 5/21 (24%) | ||
| TM helix 4 | 219..235 | CDD:320189 | 4/15 (27%) | ||
| TM helix 5 | 265..288 | CDD:320189 | 7/25 (28%) | ||
| 7tm_GPCRs | <486..564 | CDD:391938 | |||
| TM helix 6 | 488..518 | CDD:341315 | |||
| TM helix 7 | 532..557 | CDD:341315 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||