| Sequence 1: | NP_000951.1 | Gene: | PTGIR / 5739 | HGNCID: | 9602 | Length: | 386 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024569.1 | Gene: | octr-1 / 184469 | WormBaseID: | WBGene00006411 | Length: | 408 | Species: | Caenorhabditis elegans |
| Alignment Length: | 264 | Identity: | 54/264 - (20%) |
|---|---|---|---|
| Similarity: | 99/264 - (37%) | Gaps: | 51/264 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Human 4 SCRNLTYVRGSVGPATSTLMFVAGVVGNGLALGILSARRPARPSAFAVLVTGLAATDLLGTSFLS 68
Human 69 PAVFVAYARNSSLLGLARGGPALCDAFAFAMTFFGLASMLILFAMAVERCLALSHPYLYAQLDGP 133
Human 134 RCARLALPAIYAFCVLFCALPLLGLGQHQQYCPGSWCFLRMRWAQPGGAAFS-----LAYAGLVA 193
Human 194 LLVAAIFLCNGSVTLSLCRMYRQQKRHQGSLGPRPRTGEDE-VDHLILLALMTVVMAVCSLPLTI 257
Human 258 RCFT 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PTGIR | NP_000951.1 | 7tm_GPCRs | 14..304 | CDD:333717 | 51/254 (20%) |
| TM helix 1 | 16..40 | CDD:320095 | 3/23 (13%) | ||
| TM helix 2 | 50..72 | CDD:320095 | 6/21 (29%) | ||
| TM helix 3 | 93..115 | CDD:320095 | 5/21 (24%) | ||
| TM helix 4 | 138..154 | CDD:320095 | 2/15 (13%) | ||
| TM helix 5 | 181..204 | CDD:320095 | 4/27 (15%) | ||
| TM helix 6 | 235..260 | CDD:320095 | 6/24 (25%) | ||
| TM helix 7 | 271..296 | CDD:320095 | |||
| octr-1 | NP_001024569.1 | 7tmA_alpha2_AR | 22..389 | CDD:320187 | 51/256 (20%) |
| TM helix 1 | 24..48 | CDD:320187 | 3/25 (12%) | ||
| TM helix 2 | 58..80 | CDD:320187 | 6/22 (27%) | ||
| TM helix 3 | 96..118 | CDD:320187 | 5/21 (24%) | ||
| TM helix 4 | 141..157 | CDD:320187 | 2/15 (13%) | ||
| TM helix 5 | 176..199 | CDD:320187 | 3/27 (11%) | ||
| TM helix 6 | 322..347 | CDD:320187 | |||
| TM helix 7 | 357..382 | CDD:320187 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||