DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTGER1 and CG7497

DIOPT Version :9

Sequence 1:NP_000946.2 Gene:PTGER1 / 5731 HGNCID:9593 Length:402 Species:Homo sapiens
Sequence 2:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster


Alignment Length:422 Identity:98/422 - (23%)
Similarity:168/422 - (39%) Gaps:61/422 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     7 LNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQAAGRLRRRRSAA 71
            |:|.:...:||.|.|     .|:..:.....:.:..|.||...|.|||.:||:     ::....:
  Fly     8 LDLLMPHNSTTVAPP-----KALYANRNRLIIGVIIMVLGVFGNSLALFILAR-----KKLNKNS 62

Human    72 TFLLFVASLLATDLAGHVIPGAL---VLRLYTAGRAPAGGACHFLGGCMV--FFGLCPLLLGCGM 131
            .:.|.:..|...:|.  .:.|.|   :|::|.:.............|.:|  ||||....:...|
  Fly    63 KYTLMLRCLATNNLV--ALLGMLTTTLLKMYLSKEVLQSFIRVDCVGLVVWRFFGLSSGCIAAVM 125

Human   132 AVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRY--ELQYPGTWCFIGLGP 194
            |.||.:.:.||.::...::....|.::.::..:|:.:..||....|.|  |.......|......
  Fly   126 AAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRYRDA 190

Human   195 PGGWRQALLAGLFASLGLVALLAALVCNTLSGLALL----RARWRRR-------SRRPPPASGPD 248
            ||.|.:. .|.||...|.:..:..:.||......||    |:|..:|       ||....|...|
  Fly   191 PGVWNKT-YAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKNSAISID 254

Human   249 SRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMV-------------GQLV 300
                     |.|:|.::... ...||..|.|..|....|...|.|.:.             .:|:
  Fly   255 ---------PESSSGTTLYQ-TQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFAKLM 309

Human   301 GIMVVS-CICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLR-QAVLRQLL 363
            ..:.:| .|||.|.::.:.||:......:..:...:|..|.:.:...||:||:|.| :::...||
  Fly   310 AFLSISFVICWMPQMIAIPLAIAPNRVPASNKFFIIADVLTALHFTSDPYVYVLSRSKSINWSLL 374

Human   364 RLLPP-RAGAKGGPAGLGLTPSAWEASSLRSS 394
            ..:.. |:|.:.|    ||..|..:.|.:|::
  Fly   375 GCIKRWRSGWRPG----GLRRSQSDQSRMRTT 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTGER1NP_000946.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 7/27 (26%)
7tm_1 <280..351 CDD:278431 16/84 (19%)
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 45/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144959
Domainoid 1 1.000 52 1.000 Domainoid score I11441
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8162
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.