DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTGDR and ntr-2

DIOPT Version :9

Sequence 1:NP_000944.1 Gene:PTGDR / 5729 HGNCID:9591 Length:359 Species:Homo sapiens
Sequence 2:NP_510477.1 Gene:ntr-2 / 184471 WormBaseID:WBGene00008808 Length:398 Species:Caenorhabditis elegans


Alignment Length:396 Identity:81/396 - (20%)
Similarity:158/396 - (39%) Gaps:81/396 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    10 NTTSV-EKGNSAVMGGVLF---------STGLLGNLLALGLLARSGLGWCSRRPLRPLPSVFYML 64
            ||.:: .:..:|.|..:.|         ...|||||..|.::.|:  ....:|.:.|:    .:|
 Worm     4 NTLNITNQRTAAAMSQIYFLVVYQTAVMIVSLLGNLFLLFVIFRA--NQVMKRRVSPV----QLL 62

Human    65 VCGLTVTDLLGKCLLS----PVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLA 125
            :....|.||| ..|||    .:.|..|.|...        .|.:|:...:...|...:|...|:|
 Worm    63 IIHTCVADLL-FALLSLGTEILTLRTYPQYYG--------SNFVCKLMRYVQMFPMYASPFLLVA 118

Human   126 MALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHE 190
            ::.:.:.::..|..:.|....|....:|.:  |:.||. .|....|..:.::.....|  ..::.
 Worm   119 ISADRYQAICRPLAHFRSSRYRRPNWMAAI--AWGLAL-VLSIPQFFVWTKHSKTGRC--STIYG 178

Human   191 EGSLSV-LGYSVLYSSLMALL--VLATV----LC---NLGAMRNLYAM--HRRLQRHPRSCTRDC 243
            :...:| :.|.:::::|..||  :||.|    :|   .|.:.:::.||  .:|..::....|.|.
 Worm   179 QNKNTVKITYVIMFNTLAWLLPSILAAVFYYCVCKAVRLSSTKSVRAMDSQKRNGKYSSGATEDY 243

Human   244 AEPRADGREASPQPLEELDH------LLLLALMTVLFTM----CSLPVIYRAYYGAFKDVKEKNR 298
            .|......:...|.:.|.|.      .|.:.::...|.:    |.:.||...:            
 Worm   244 IEELRKKSKGFRQQMSEFDRKRVQTVRLTITIVACNFFLWMPFCLINVIQALW------------ 296

Human   299 TSEEAEDLRALRFLSVI----SIVDPWIFIIF-RSPVFRIF--FHKIFIRPLRYRS----RCSNS 352
              .|...:..:.:::::    |.::|||:|:| ||.|.:..  ..:.|....:.||    .||::
 Worm   297 --PEISHIMFINYVAILGNLNSCLNPWIYILFNRSHVRKALCRSRRSFTEVTKKRSFENFECSST 359

Human   353 TNMESS 358
            ..|.::
 Worm   360 ATMNNN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTGDRNP_000944.1 7tmA_PGD2 17..335 CDD:320268 73/359 (20%)
TM helix 1 18..44 CDD:320268 9/34 (26%)
TM helix 2 61..87 CDD:320268 9/29 (31%)
TM helix 3 105..135 CDD:320268 5/29 (17%)
TM helix 4 147..169 CDD:320268 6/21 (29%)
TM helix 5 195..224 CDD:320268 10/38 (26%)
TM helix 6 258..288 CDD:320268 7/39 (18%)
TM helix 7 302..327 CDD:320268 7/29 (24%)
ntr-2NP_510477.1 7tm_1 37..323 CDD:278431 62/319 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.