| Sequence 1: | NP_000944.1 | Gene: | PTGDR / 5729 | HGNCID: | 9591 | Length: | 359 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024569.1 | Gene: | octr-1 / 184469 | WormBaseID: | WBGene00006411 | Length: | 408 | Species: | Caenorhabditis elegans |
| Alignment Length: | 283 | Identity: | 69/283 - (24%) |
|---|---|---|---|
| Similarity: | 106/283 - (37%) | Gaps: | 68/283 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Human 31 LLGNLLALGLLARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRV 95
Human 96 LAP-ALDNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFYRRHIT-LRLGALVAPVVSA 158
Human 159 FSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSV---LGYSVLYSSLMALLVLATVLCNLG 220
Human 221 AMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRA 285
Human 286 YY------GAFKDVKEKNRTSEE 302 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PTGDR | NP_000944.1 | 7tmA_PGD2 | 17..335 | CDD:320268 | 69/283 (24%) |
| TM helix 1 | 18..44 | CDD:320268 | 4/12 (33%) | ||
| TM helix 2 | 61..87 | CDD:320268 | 8/25 (32%) | ||
| TM helix 3 | 105..135 | CDD:320268 | 7/29 (24%) | ||
| TM helix 4 | 147..169 | CDD:320268 | 6/21 (29%) | ||
| TM helix 5 | 195..224 | CDD:320268 | 13/31 (42%) | ||
| TM helix 6 | 258..288 | CDD:320268 | 8/35 (23%) | ||
| TM helix 7 | 302..327 | CDD:320268 | 0/1 (0%) | ||
| octr-1 | NP_001024569.1 | 7tmA_alpha2_AR | 22..389 | CDD:320187 | 69/283 (24%) |
| TM helix 1 | 24..48 | CDD:320187 | 4/11 (36%) | ||
| TM helix 2 | 58..80 | CDD:320187 | 7/23 (30%) | ||
| TM helix 3 | 96..118 | CDD:320187 | 4/21 (19%) | ||
| TM helix 4 | 141..157 | CDD:320187 | 4/16 (25%) | ||
| TM helix 5 | 176..199 | CDD:320187 | 10/23 (43%) | ||
| TM helix 6 | 322..347 | CDD:320187 | |||
| TM helix 7 | 357..382 | CDD:320187 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||