DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTEN and Pten

DIOPT Version :9

Sequence 1:NP_001291646.4 Gene:PTEN / 5728 HGNCID:9588 Length:576 Species:Homo sapiens
Sequence 2:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster


Alignment Length:438 Identity:173/438 - (39%)
Similarity:239/438 - (54%) Gaps:86/438 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   174 MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPA-ERLEGVYRNNIDDVVRFLDSKHKNH 237
            |:.:|:.:||:.:.||:|.|:|||||||..||||||:|| ::|||::||.::||.:.|:..|..|
  Fly     8 MSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQH 72

Human   238 YKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKG 302
            |||||||:||.||.|||..|||.|||:|||||.:|||:.||.|:|.||.||.::|.|:|||||||
  Fly    73 YKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKG 137

Human   303 RTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALL 367
            |||.||||||:..|....|.|||.:|.|.||:|:||||||||||||.|:|.|:.:.:.|..|:|.
  Fly   138 RTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLVCSSVPYSKVSLN 202

Human   368 FHKMMFETIPMFSGGTC--NPQFVVCQLKVKIYSS---NSGPTRRE------DKFMYFEFPQPLP 421
            ..::      .||..:|  |...|.|.:.| ::.|   |:.|.|.:      .|.........:|
  Fly   203 VCEI------RFSESSCVQNLGMVECSISV-LHDSATENAKPDRLKTLPIDFQKSFVLTIKPSIP 260

Human   422 VCGDIKVEFFHKQNKMLKKDKMF-HFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADND 485
            |.||:|.|...|     ..||:. |||:||||          |.|.|.|:           :|..
  Fly   261 VSGDVKFELTKK-----SPDKIICHFWLNTFF----------VRNYSPCE-----------SDGT 299

Human   486 KEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYF---------------TKTVEEPSNPEASSS 535
            ....:.||:|:::|..:||..::.||..||:.:.|               .:..|...|.|.|..
  Fly   300 VNKYIHTLSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSNDVQAEASEKERNENVLNFERSDY 364

Human   536 TSVTPD-----------VSDNEP--------DH------YRYSDTTDS 558
            .|::|:           |:||..        ||      .:|..:|:|
  Fly   365 DSLSPNCYAEKKVLTAIVNDNTTKSQTIETLDHKDIVTKIQYDTSTNS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTENNP_001291646.4 None
PtenNP_001162933.1 PTPc 58..167 CDD:304379 66/108 (61%)
PTEN_C2 196..335 CDD:287393 46/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159149
Domainoid 1 1.000 118 1.000 Domainoid score I5891
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H265
Inparanoid 1 1.050 283 1.000 Inparanoid score I2874
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52467
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001369
OrthoInspector 1 1.000 - - oto90056
orthoMCL 1 0.900 - - OOG6_100936
Panther 1 1.100 - - LDO PTHR12305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1027
SonicParanoid 1 1.000 - - X965
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.