DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTEN and aux

DIOPT Version :9

Sequence 1:NP_001291646.4 Gene:PTEN / 5728 HGNCID:9588 Length:576 Species:Homo sapiens
Sequence 2:NP_649438.1 Gene:aux / 40527 FlyBaseID:FBgn0037218 Length:1165 Species:Drosophila melanogaster


Alignment Length:506 Identity:112/506 - (22%)
Similarity:182/506 - (35%) Gaps:120/506 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   101 PLAAEEKQAQSLQPSSSRRSSHYPAAVQSQAAAERGASATAKSRAISILQKKPRHQQLLPSL--S 163
            ||.......:||...|..:||.|........:|...:|...             |..||.||  .
  Fly   333 PLDLHIMPIESLPAESPLKSSAYSEVYTEPLSAAIPSSYNG-------------HGSLLSSLRGG 384

Human   164 SFFFSHRLPDMTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYR-NNIDDVV 227
            :......:.|.:..:.:.:.::..|.     |||:::|...|:.|..|::..|..|: |||:||.
  Fly   385 AGTLLKNIKDTSTKVMQTMQQSLARN-----DLDISHITSRILVMPCPSDGFESTYKTNNIEDVR 444

Human   228 RFLDSKH-KNHYKIYNLCAERHYDTAKFNCRVAQ----YPFEDHNPPQLELIKPFCEDLDQWLSE 287
            ..|:|:. .....|||. .:|.........|..:    |.....:.|.|:.:.....|:..:|:.
  Fly   445 LSLESRFVPQKLSIYNF-GQRTEPRLPPPVRTVEAGSVYGCPQAHAPNLQGLFTVSADMYNFLNA 508

Human   288 DDNHVAAIHCKAGKGRT-GVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTI---PSQRRYV 348
            |...|..:......|.| ..:|||.|::.....:.::|:..:...|.      ||   ||:.||:
  Fly   509 DPKSVVIVQTGDSGGCTAATVICALLMYADLLREPEDAVQVFAVKRH------TINLRPSEFRYL 567

Human   349 YYYSYLLKNHLDYRPVALLFH-------KMMFETIPMFSGGT----------CNPQFVVCQL--- 393
            ||:..:|      ||..||.|       .:..:.:|..:...          ||...::..|   
  Fly   568 YYFGDIL------RPTPLLPHYKNTTLVSLSCQPVPRMTKARDGCRIYMEVYCNGNLLLSTLQDY 626

Human   394 -KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKD--KMFHFWVNTFFIPG 455
             |:::|.:..|.         ...|..|..|||:.|..||.:..|::..  |:..|..||.|||.
  Fly   627 EKMRLYQAGPGK---------IVLPINLTACGDVTVVLFHARKGMVRPQGLKICQFQFNTGFIPE 682

Human   456 PEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYF 520
            ||                               .::|.|..|||.....:   ..:|.|.|.|..
  Fly   683 PE-------------------------------TLITFTNQDLDDLPDPE---QVTPRFCVSLSL 713

Human   521 TKTVEE----------PSNPEASSSTSVTPDVSDNEP-DHYRYSDTTDSDP 560
            ..|..|          |:.|:.|.:...:.|:...|. |::....:|.|.|
  Fly   714 AVTDSESPPSHKPPWMPAKPKRSPAALFSSDLEYAEMLDNFVTKPSTRSSP 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTENNP_001291646.4 None
auxNP_649438.1 PKc_like 49..326 CDD:304357
S_TKc 51..317 CDD:214567
PTEN_C2 581..711 CDD:287393 34/172 (20%)
DnaJ <1110..1150 CDD:197617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.